PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01331.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 311aa    MW: 33043.3 Da    PI: 7.8458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01331.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.8e-191461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEde+lv++++ +G g+W++++r  g+ R++k+c++rw +yl
  Zmw_sc01331.1.g00030.1.am.mk 14 RGLWSPEEDEKLVKYITTHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
                                  788*******************************************97 PP

2Myb_DNA-binding53.17.4e-1767110146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E+ l+++++++lG++ W+ Ia++++ gRt++++k++w++
  Zmw_sc01331.1.g00030.1.am.mk  67 RGSFSQQEEALIIELHRMLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                                   899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.501961IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002497.3E-161461IPR001005SANT/Myb domain
CDDcd001674.71E-121761No hitNo description
PROSITE profilePS5129426.82862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2665117IPR009057Homeodomain-like
SMARTSM007174.5E-1766114IPR001005SANT/Myb domain
PfamPF002497.7E-1667110IPR001005SANT/Myb domain
CDDcd001671.68E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT THGHGCWSSV PRQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEEALIIE LHRMLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VSSLHHPGNV PAAADLYYNI LDGAGQGMAA AGCAPLHGDA PNASSHTTVS TPSPSSMMHN  180
PAAWADFGSQ PFLLPGHGVH GSGDLQYAID GEFIKLCHAA DAYPPENGAG GVAGQCKTSA  240
GLVGPEGAAV RSLPVFLEPK GTGAFAAEPA MGPVVDFMEA ILGSSSTSAV SASSVDSFSG  300
NTGMQPHSWI P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969713.11e-164PREDICTED: myb-related protein Hv1-like isoform X1
TrEMBLK3XK961e-163K3XK96_SETIT; Uncharacterized protein
STRINGSi002319m1e-162(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035